PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10022033m
Common NameCICLE_v10022033mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 233aa    MW: 25398.8 Da    PI: 10.2947
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10022033mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.33.7e-25126170145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr rsrk +e+
  Ciclev10022033m 126 DPEPGRCRRTDGKKWRCSKEAIPDHKYCERHVHRGRLRSRKLVEA 170
                      79****************************************997 PP

2QLQ39.81.3e-145791337
              QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     FT  Qlq+L  Q l++Ky+ a++PvP++L+ +i+k
  Ciclev10022033m 57 FTIFQLQELQLQSLIFKYMEARLPVPSQLVIPIWK 91
                     7778*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.5E-55591IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.9525691IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.5E-105790IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.796126170IPR014977WRC domain
PfamPF088795.4E-21127169IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MKPQNPPTKL ARLADFGTGR ANWSRSCSME SSKGDGSPSI ALELELGTGC SKRSYGFTIF  60
QLQELQLQSL IFKYMEARLP VPSQLVIPIW KSVASSVSGL SGDLHQLYPS FYGSGSLHLE  120
LKNGMDPEPG RCRRTDGKKW RCSKEAIPDH KYCERHVHRG RLRSRKLVEA SRRSPSTSSA  180
ITNANTNLSI SLPAVNNSST AIATASNPSP NFGFSPRSVL YDGGNKKLEP SL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006440462.11e-172hypothetical protein CICLE_v10022033mg
TrEMBLV4TJZ71e-172V4TJZ7_9R
STRINGPOPTR_0001s08310.12e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16724712
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-38growth-regulating factor 2